Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX1 Peptide - N-terminal region

SNX1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SNX1

UniProt

Q13596

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX1 Rabbit Polyclonal Antibody (orb331461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITTSLLPINNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mi2-β (H-7) : m-IgGκ BP-HRP Bundle
sc-524032 1 Kit

Mi2-β (H-7) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
YPEL1 Human qPCR Primer Pair (NM_013313)
HP210470 200 Reactions

YPEL1 Human qPCR Primer Pair (NM_013313)

Sign In for Pricing
View Details
IFT20 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV624784 1.0 µg DNA

IFT20 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
CDH20 Double Nickase Plasmid (m)
sc-423857-NIC 20 µg

CDH20 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
Recombinant Geobacillus thermodenitrificans Small, acid-soluble spore protein tlp (tlp)
MBS1185304-01 0.02 mg (E-Coli)

Recombinant Geobacillus thermodenitrificans Small, acid-soluble spore protein tlp (tlp)

Sign In for Pricing
View Details
Recombinant Geobacillus thermodenitrificans Small, acid-soluble spore protein tlp (tlp)
MBS1185304-02 0.1 mg (E-Coli)

Recombinant Geobacillus thermodenitrificans Small, acid-soluble spore protein tlp (tlp)

Sign In for Pricing
View Details