Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SNX1 Peptide - N-terminal region

SNX1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

SNX1

UniProt

Q13596

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SNX1 Rabbit Polyclonal Antibody (orb331461) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: ITTSLLPINNGSKENGIHEEQDQEPQDLFADATVELSLDSTQNNQKKVLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR137C Lentiviral Activation Particles (m2)
sc-427781-LAC-2 200 µL

GPR137C Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
Ku70 / XRCC6 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated
bs-2295R-BF680 100 µL

Ku70 / XRCC6 Polyclonal Antibody, AbBy Fluor™ 680 Conjugated

Sign In for Pricing
View Details
Lentiviral human IFNLR1 sgRNA gene knockout kit - Lentiviral human IFNLR1 sgRNA gene knockout kit (25)
GTR15395286 1 Vial

Lentiviral human IFNLR1 sgRNA gene knockout kit - Lentiviral human IFNLR1 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O157:H7 YCJV Polyclonal Antibody
MBS9003467 Inquire

Rabbit anti-Escherichia coli O157:H7 YCJV Polyclonal Antibody

Sign In for Pricing
View Details
GPT Recombinant Protein (Mouse)
OPCA04419-1MG 1 mg

GPT Recombinant Protein (Mouse)

Sign In for Pricing
View Details
C11orf64 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K0286007 1.0 µg DNA

C11orf64 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details