Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA20 Peptide - C-terminal region

SPATA20 Peptide - C-terminal region

Product Specifications

UniProt

Q8TB22

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA20 Rabbit Polyclonal Antibody (orb580242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGATEPLTSGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SAA4 Double Nickase Plasmid (h2)
sc-410996-NIC-2 20 µg

SAA4 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
RGD1565744 ORF Vector (Rat) (pORF)
ORF075267 1.0 µg DNA

RGD1565744 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Horse Mucin 13, Cell Surface Associated ELISA Kit
MBS077723-01 48 Well

Horse Mucin 13, Cell Surface Associated ELISA Kit

Sign In for Pricing
View Details
Horse Mucin 13, Cell Surface Associated ELISA Kit
MBS077723-02 96 Well

Horse Mucin 13, Cell Surface Associated ELISA Kit

Sign In for Pricing
View Details
Horse Mucin 13, Cell Surface Associated ELISA Kit
MBS077723-03 5x 96 Well

Horse Mucin 13, Cell Surface Associated ELISA Kit

Sign In for Pricing
View Details
Horse Mucin 13, Cell Surface Associated ELISA Kit
MBS077723-04 10x 96 Well

Horse Mucin 13, Cell Surface Associated ELISA Kit

Sign In for Pricing
View Details