Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPATA20 Peptide - C-terminal region

SPATA20 Peptide - C-terminal region

Product Specifications

UniProt

Q8TB22

Field of Research

Stem Cell & Developmental Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SPATA20 Rabbit Polyclonal Antibody (orb580242) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GFYSAEDADSPPERGQRPKEGAYYVWTVKEVQQLLPEPVLGATEPLTSGQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CCNY Antibody (OTI12F10) [DyLight 680]
NBP2-72462FR 0.1 mL

Mouse Monoclonal CCNY Antibody (OTI12F10) [DyLight 680]

Sign In for Pricing
View Details
Recombinant Chicken Protein Wnt-11 (WNT11)
MBS955618-01 0.05 mg (E-Coli)

Recombinant Chicken Protein Wnt-11 (WNT11)

Sign In for Pricing
View Details
Recombinant Chicken Protein Wnt-11 (WNT11)
MBS955618-02 0.05 mg (Yeast)

Recombinant Chicken Protein Wnt-11 (WNT11)

Sign In for Pricing
View Details
Recombinant Chicken Protein Wnt-11 (WNT11)
MBS955618-03 0.2 mg (E-Coli)

Recombinant Chicken Protein Wnt-11 (WNT11)

Sign In for Pricing
View Details
Recombinant Chicken Protein Wnt-11 (WNT11)
MBS955618-04 0.05 mg (Baculovirus)

Recombinant Chicken Protein Wnt-11 (WNT11)

Sign In for Pricing
View Details
Recombinant Chicken Protein Wnt-11 (WNT11)
MBS955618-05 0.5 mg (E-Coli)

Recombinant Chicken Protein Wnt-11 (WNT11)

Sign In for Pricing
View Details