Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A24 Peptide - N-terminal region

SLC25A24 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APC1, SCAMC1, SCAMC-1

UniProt

Q6NUK1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A24 Rabbit Polyclonal Antibody (orb325107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

17a-Trenbolone(3) [HRP]
DAG1001 0.5ml

17a-Trenbolone(3) [HRP]

Sign In for Pricing
View Details
TMTC4 AAV Vector (Human) (CMV)
47179101 1 µg

TMTC4 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
SH3BP4 Rabbit pAb, PE-Cy7 conjugated
orb2881913 100 µL

SH3BP4 Rabbit pAb, PE-Cy7 conjugated

Sign In for Pricing
View Details
CAMK2D (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit delta, CaM Kinase II Subunit delta, CaMK-II Subunit delta, CAMKD) (APC)
124290-APC 100 µL

CAMK2D (Calcium/Calmodulin-dependent Protein Kinase Type II Subunit delta, CaM Kinase II Subunit delta, CaMK-II Subunit delta, CAMKD) (APC)

Sign In for Pricing
View Details
PRPF40A (Pre-mRNA-Processing Factor 40 Homolog A)
489448 100 µL

PRPF40A (Pre-mRNA-Processing Factor 40 Homolog A)

Sign In for Pricing
View Details
Morusin
C07387-5mg 5 mg

Morusin

Sign In for Pricing
View Details