Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A24 Peptide - N-terminal region

SLC25A24 Peptide - N-terminal region

Product Specifications

Product Name Alternative

APC1, SCAMC1, SCAMC-1

UniProt

Q6NUK1

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLC25A24 Rabbit Polyclonal Antibody (orb325107) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LDRNGDGVVDIGELQEGLRNLGIPLGQDAEEKIFTTGDVNKDGKLDFEEF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat MT (Melatonin) ELISA Kit
EG0019 96 Tests

Goat MT (Melatonin) ELISA Kit

Sign In for Pricing
View Details
Monkey Nucleoporin 50kDa ELISA kit
GTR10442793 96 Well

Monkey Nucleoporin 50kDa ELISA kit

Sign In for Pricing
View Details
HARS2 CRISPR Activation Plasmid (h)
sc-411741-ACT 20 µg

HARS2 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Peroxiredoxin 5 (PRDX5, PLP, PRDX6, ACR1, B166, PMP20, PRXV, SBBI10, Thioredoxin Peroxidase PMP20, Peroxisomal Antioxidant Enzyme, TPx Type VI, Liver Tissue 2D-Page Spot 71B, Alu Co-Repressor 1)
141829 200 µL

Peroxiredoxin 5 (PRDX5, PLP, PRDX6, ACR1, B166, PMP20, PRXV, SBBI10, Thioredoxin Peroxidase PMP20, Peroxisomal Antioxidant Enzyme, TPx Type VI, Liver Tissue 2D-Page Spot 71B, Alu Co-Repressor 1)

Sign In for Pricing
View Details
Rat Arhgef19 Pre-designed siRNA Set B
SI200883B 1 Each

Rat Arhgef19 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Recombinant HAdV-5 PIX Protein (aa 1-140)
VAng-Cr4367-500gEcoli 500 µg (E. coli)

Recombinant HAdV-5 PIX Protein (aa 1-140)

Sign In for Pricing
View Details