SPINT2 Peptide - middle region
SPINT2 Peptide - middle region
Product Specifications
Product Name Alternative
PB, Kop, HAI2, DIAR3, HAI-2
UniProt
O43291
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPINT2 Rabbit Polyclonal Antibody (orb325491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066925
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRA
More Discoveries
Explore Other Products
Browse additional items from our catalog
bsm-62828R-FITC 100 µL
Somatostatin 28 Recombinant Antibody, FITC Conjugated
Sign In for Pricing
View Details 
MBS1150366-01 0.02 mg (E-Coli)
Recombinant Enterobacter sp. DNA replication terminus site-binding protein (tus)
Sign In for Pricing
View Details MBS1150366-02 0.02 mg (Yeast)
Recombinant Enterobacter sp. DNA replication terminus site-binding protein (tus)
Sign In for Pricing
View Details