SPINT2 Peptide - middle region
SPINT2 Peptide - middle region
Product Specifications
Product Name Alternative
PB, Kop, HAI2, DIAR3, HAI-2
UniProt
O43291
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SPINT2 Rabbit Polyclonal Antibody (orb325491) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_066925
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ATGDLATSRNAADSSVPSAPRRQDSEDHSSDMFNYEEYCTANAVTGPCRA
More Discoveries
Explore Other Products
Browse additional items from our catalog
K2499308 1.0 µg DNA
TRNAK38P sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 
K4100407 1.0 µg DNA
Rnpep sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
Sign In for Pricing
View Details 
43430126 3x 1.0µg DNA
SERINC2 CRISPRa sgRNA lentivector (set of three targets)(Rat)
Sign In for Pricing
View Details MBS2096101-01 0.1 mL
Biotin-Linked Polyclonal Antibody to TNF Receptor Associated Factor 1 (TRAF1)
Sign In for Pricing
View Details