Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TICAM2 Peptide - N-terminal region

TICAM2 Peptide - N-terminal region

Product Specifications

Product Name Alternative

TIRP, TRAM, TICAM2, TIRAP3, MyD88-4, TICAM-2

UniProt

Q86XR7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TICAM2 Rabbit Polyclonal Antibody (orb326515) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_067681

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VDTSPGYHESDSKKSEDLSLCNVAEHSNTTEGPTGKQEGAQSVEEMFEEE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aasdhppt Mouse shRNA Lentiviral Particle (Locus ID 67618)
TL503955V 500 µL Each

Aasdhppt Mouse shRNA Lentiviral Particle (Locus ID 67618)

Sign In for Pricing
View Details
Glutaminase Rabbit mAb
MBS9469888-01 0.05 mL

Glutaminase Rabbit mAb

Sign In for Pricing
View Details
Glutaminase Rabbit mAb
MBS9469888-02 0.1 mL

Glutaminase Rabbit mAb

Sign In for Pricing
View Details
Glutaminase Rabbit mAb
MBS9469888-03 5x 0.1 mL

Glutaminase Rabbit mAb

Sign In for Pricing
View Details
Lentiviral human LRCH4 sgRNA gene knockout kit - Lentiviral human LRCH4 sgRNA gene knockout kit (25)
GTR15390396 1 Vial

Lentiviral human LRCH4 sgRNA gene knockout kit - Lentiviral human LRCH4 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
TRNAT3 3'UTR GFP Stable Cell Line
TU077157 1.0 mL

TRNAT3 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details