Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PPT2 Peptide - C-terminal region

PPT2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

PPT2

UniProt

Q9UMR5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PPT2 Rabbit Polyclonal Antibody (orb588148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1-Ethylpyrrole
TRC-E925693-500MG 500 mg

1-Ethylpyrrole

Sign In for Pricing
View Details
Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), 1mg/mL
BNUM2587-50 1x 50 µL

Cyclin E (G1/S-Phase Cyclin) (CCNE1/2587), 1mg/mL

Sign In for Pricing
View Details
Frozen Tissue Sections, Parotid gland
CS622117 5x 5 µm

Frozen Tissue Sections, Parotid gland

Sign In for Pricing
View Details
MOBP (NM_001278322) Human Tagged ORF Clone
RG236566 10 µg

MOBP (NM_001278322) Human Tagged ORF Clone

Sign In for Pricing
View Details
1-Cyclopentyl-4-nitrosopiperazine
TRC-C213795-1G 1 g

1-Cyclopentyl-4-nitrosopiperazine

Sign In for Pricing
View Details
Snrpd2 (NM_026943) Mouse Tagged ORF Clone
MG200538 10 µg

Snrpd2 (NM_026943) Mouse Tagged ORF Clone

Sign In for Pricing
View Details