PPT2 Peptide - C-terminal region
PPT2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
PPT2
UniProt
Q9UMR5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with PPT2 Rabbit Polyclonal Antibody (orb588148) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DLYLNASSFLALINGERDHPNATVWRKNFLRVGHLVLIGGPDDGVITPWQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNUB2050-100 1x 100 µL
Human Kappa Light Chain / IGKC (B-Cell Marker) (rKLC709), 0.2mg/mL
Sign In for Pricing
View Details 
KN424517 1 Kit
RB associated KRAB repressor (RBAK) Human Gene Knockout Kit (CRISPR)
Sign In for Pricing
View Details