Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKD3 Peptide - middle region

PRKD3 Peptide - middle region

Product Specifications

Product Name Alternative

EPK2, PKD3, PRKCN, PKC-NU, nPKC-NU

UniProt

O94806

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKD3 Rabbit Polyclonal Antibody (orb327363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005264294

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEVTFNGEPSSLGTDTDIPMDIDNNDINSDSSRGLDDTEEPSPPEDKMFF

More Discoveries

Explore Other Products

Browse additional items from our catalog

CPT1B Rabbit Polyclonal Antibody (HRP)
orb2600201 100 µg

CPT1B Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
CaMKII (Phospho-Thr286) Antibody
E011287-1 50 µg - 50 µL

CaMKII (Phospho-Thr286) Antibody

Sign In for Pricing
View Details
MAP4K5 sgRNA CRISPR Lentivector (Human) (Target 1)
K1265202 1.0 µg DNA

MAP4K5 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Tmem108 3'UTR GFP Stable Cell Line
TU272003 1.0 mL

Tmem108 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
2-Acetamido-3,4,6-tri-O-acetyl-2-deoxy-b-D-glucopyranosyl amine
292314-01 5 mg

2-Acetamido-3,4,6-tri-O-acetyl-2-deoxy-b-D-glucopyranosyl amine

Sign In for Pricing
View Details
2-Acetamido-3,4,6-tri-O-acetyl-2-deoxy-b-D-glucopyranosyl amine
292314-02 10 mg

2-Acetamido-3,4,6-tri-O-acetyl-2-deoxy-b-D-glucopyranosyl amine

Sign In for Pricing
View Details