Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PRKD3 Peptide - middle region

PRKD3 Peptide - middle region

Product Specifications

Product Name Alternative

EPK2, PKD3, PRKCN, PKC-NU, nPKC-NU

UniProt

O94806

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with PRKD3 Rabbit Polyclonal Antibody (orb327363) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

XP_005264294

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GEVTFNGEPSSLGTDTDIPMDIDNNDINSDSSRGLDDTEEPSPPEDKMFF

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNU7-33P-set siRNA/shRNA/RNAi Lentivector (Human)
40543091 4x 500 ng

RNU7-33P-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
OCIAD2 Rabbit pAb
E45R21516N-50 50 µL

OCIAD2 Rabbit pAb

Sign In for Pricing
View Details
Rat Epoxide Hydrolase 2, Cytoplasmic (EPHX2) ELISA Kit
abx527757 96 Tests

Rat Epoxide Hydrolase 2, Cytoplasmic (EPHX2) ELISA Kit

Sign In for Pricing
View Details
Integrin, alpha2 beta1 (VLA2) (MaxLight 405) discontinued
I7661-32F-ML405 100 µL

Integrin, alpha2 beta1 (VLA2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Recombinant Mesocricetus auratus Cytochrome P450 1A2 (CYP1A2), partial
MBS1025967 Inquire

Recombinant Mesocricetus auratus Cytochrome P450 1A2 (CYP1A2), partial

Sign In for Pricing
View Details
MMP3 Antibody
orb1316274 100 µL

MMP3 Antibody

Sign In for Pricing
View Details