Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1ORF61 Peptide - N-terminal region

C1ORF61 Peptide - N-terminal region

Product Specifications

Product Name Alternative

CROC4

UniProt

Q13536

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1ORF61 Rabbit Polyclonal Antibody (orb575271) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006711182

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: NLRNFLLFQLWESSFSPGAGGFCTTLPPSFLRVDDRATSSTTDSSRAPSS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CD80 Rat mAb, APC conjugated
orb1184237-01 25 Tests

Mouse CD80 Rat mAb, APC conjugated

Sign In for Pricing
View Details
Mouse CD80 Rat mAb, APC conjugated
orb1184237-02 50 Tests

Mouse CD80 Rat mAb, APC conjugated

Sign In for Pricing
View Details
Mouse CD80 Rat mAb, APC conjugated
orb1184237-03 100 Tests

Mouse CD80 Rat mAb, APC conjugated

Sign In for Pricing
View Details
TIMP4 Antibody
MBS8510775-01 0.05 mg

TIMP4 Antibody

Sign In for Pricing
View Details
TIMP4 Antibody
MBS8510775-02 0.1 mg

TIMP4 Antibody

Sign In for Pricing
View Details
TIMP4 Antibody
MBS8510775-03 0.1 mL (AF750)

TIMP4 Antibody

Sign In for Pricing
View Details