C1QTNF2 Peptide - C-terminal region
C1QTNF2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CTRP2, zacrp2
UniProt
Q9BXJ5
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with C1QTNF2 Rabbit Polyclonal Antibody (orb325741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: IYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQ
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS2059920-01 0.1 mL
APC/CY7-Linked Polyclonal Antibody to Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)
Sign In for Pricing
View Details MBS2059920-02 0.2 mL
APC/CY7-Linked Polyclonal Antibody to Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)
Sign In for Pricing
View Details MBS2059920-03 0.5 mL
APC/CY7-Linked Polyclonal Antibody to Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)
Sign In for Pricing
View Details MBS2059920-04 1 mL
APC/CY7-Linked Polyclonal Antibody to Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)
Sign In for Pricing
View Details MBS2059920-05 5 mL
APC/CY7-Linked Polyclonal Antibody to Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)
Sign In for Pricing
View Details MBS2059920-06 5x 5 mL
APC/CY7-Linked Polyclonal Antibody to Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1)
Sign In for Pricing
View Details