Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C1QTNF2 Peptide - C-terminal region

C1QTNF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CTRP2, zacrp2

UniProt

Q9BXJ5

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with C1QTNF2 Rabbit Polyclonal Antibody (orb325741) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: IYYFTYDITLANKHLAIGLVHNGQYRIRTFDANTGNHDVASGSTILALKQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGC95210 3'UTR Luciferase Stable Cell Line
TU213168 1.0 mL

MGC95210 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SPATA7 Rabbit pAb, PE-Cy5.5 conjugated
orb2849930 100 µL

SPATA7 Rabbit pAb, PE-Cy5.5 conjugated

Sign In for Pricing
View Details
GAK Antibody, HRP conjugated
CSB-PA009190LB01HU-01 50 µg

GAK Antibody, HRP conjugated

Sign In for Pricing
View Details
GAK Antibody, HRP conjugated
CSB-PA009190LB01HU-02 100 µg

GAK Antibody, HRP conjugated

Sign In for Pricing
View Details
K0284 Antibody
C44316-01 50 µL

K0284 Antibody

Sign In for Pricing
View Details
K0284 Antibody
C44316-02 100 µL

K0284 Antibody

Sign In for Pricing
View Details