VAT1 Peptide - N-terminal region
VAT1 Peptide - N-terminal region
Product Specifications
Product Name Alternative
VAT1
UniProt
Q99536
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with VAT1 Rabbit Polyclonal Antibody (orb327287) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006364
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: ATGEDASSPPPKTEAASDPQHPAASEGAAAAAASPPLLRCLVLTGFGGYD
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-CK-A280-01 20 Assays
Annexin V-Elab Fluor® Red 780/DAPI Apoptosis Kit
Sign In for Pricing
View Details E-CK-A280-02 100 Assays
Annexin V-Elab Fluor® Red 780/DAPI Apoptosis Kit
Sign In for Pricing
View Details 
