Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTA2 Peptide - C-terminal region

MTA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MTA2, MTA1L1, PID

UniProt

O94776

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTA2 Rabbit Polyclonal Antibody (orb588303) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004730

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Calcium uptake protein 1, mitochondrial (MICU1) Antibody (HRP)
abx334911-01 20 µg

Calcium uptake protein 1, mitochondrial (MICU1) Antibody (HRP)

Sign In for Pricing
View Details
Calcium uptake protein 1, mitochondrial (MICU1) Antibody (HRP)
abx334911-02 50 µg

Calcium uptake protein 1, mitochondrial (MICU1) Antibody (HRP)

Sign In for Pricing
View Details
Calcium uptake protein 1, mitochondrial (MICU1) Antibody (HRP)
abx334911-03 100 µg

Calcium uptake protein 1, mitochondrial (MICU1) Antibody (HRP)

Sign In for Pricing
View Details
Calcium uptake protein 1, mitochondrial (MICU1) Antibody (HRP)
abx334911-04 200 µg

Calcium uptake protein 1, mitochondrial (MICU1) Antibody (HRP)

Sign In for Pricing
View Details
Calcium uptake protein 1, mitochondrial (MICU1) Antibody (HRP)
abx334911-05 1 mg

Calcium uptake protein 1, mitochondrial (MICU1) Antibody (HRP)

Sign In for Pricing
View Details
Mouse SCCA2 -Squamous Cell Carcinoma Antigen 2- CLIA Kit
E-CL-M0618-01 24 Tests

Mouse SCCA2 -Squamous Cell Carcinoma Antigen 2- CLIA Kit

Sign In for Pricing
View Details