Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MTA2 Peptide - C-terminal region

MTA2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

MTA2, MTA1L1, PID

UniProt

O94776

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with MTA2 Rabbit Polyclonal Antibody (orb588303) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_004730

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pCMV-SPORT6-F12 Plasmid
PVT13753 2 µg

pCMV-SPORT6-F12 Plasmid

Sign In for Pricing
View Details
Vom1r52 3'UTR GFP Stable Cell Line
TU273110 1.0 mL

Vom1r52 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human CCS Protein, His, E.coli-25ug
QP11299-25ug 25ug

Recombinant Human CCS Protein, His, E.coli-25ug

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Pronociceptin (PNOC)
MBS2095258-01 0.1 mL

Biotin-Linked Polyclonal Antibody to Pronociceptin (PNOC)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Pronociceptin (PNOC)
MBS2095258-02 0.2 mL

Biotin-Linked Polyclonal Antibody to Pronociceptin (PNOC)

Sign In for Pricing
View Details
Biotin-Linked Polyclonal Antibody to Pronociceptin (PNOC)
MBS2095258-03 0.5 mL

Biotin-Linked Polyclonal Antibody to Pronociceptin (PNOC)

Sign In for Pricing
View Details