Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUC7L2 Peptide - C-terminal region

LUC7L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-59, CGI-74, LUC7B2

UniProt

Q9Y383

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LUC7L2 Rabbit Polyclonal Antibody (orb327379) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057103

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRDRSRERSKRRSSKERFRDQDLASCDRDRSSRDRSPRDRDRKDKKRSYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Transmembrane Protein 19 (TMEM19) ELISA Kit
abx550484 96 Tests

Rat Transmembrane Protein 19 (TMEM19) ELISA Kit

Sign In for Pricing
View Details
APRT (NM_000485) Human Recombinant Protein
TP316874 20 µg

APRT (NM_000485) Human Recombinant Protein

Sign In for Pricing
View Details
Bcl-2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated
bsm-52304R-BF647-TR 20 µL

Bcl-2 Recombinant Antibody, AbBy Fluor™ 647 Conjugated

Sign In for Pricing
View Details
BHQ-2-dT 2 umol scale
26-6653-03 1 Each

BHQ-2-dT 2 umol scale

Sign In for Pricing
View Details
TIGD1 Rabbit Polyclonal Antibody
APRab18934-01 20 µL

TIGD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TIGD1 Rabbit Polyclonal Antibody
APRab18934-02 50 µL

TIGD1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details