Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LUC7L2 Peptide - C-terminal region

LUC7L2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CGI-59, CGI-74, LUC7B2

UniProt

Q9Y383

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with LUC7L2 Rabbit Polyclonal Antibody (orb327379) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_057103

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: SRDRSRERSKRRSSKERFRDQDLASCDRDRSSRDRSPRDRDRKDKKRSYE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse TARM1 Protein, N-His
orb3056817-01 50 µg

Recombinant Mouse TARM1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse TARM1 Protein, N-His
orb3056817-02 100 µg

Recombinant Mouse TARM1 Protein, N-His

Sign In for Pricing
View Details
Recombinant Mouse TARM1 Protein, N-His
orb3056817-03 1 mg

Recombinant Mouse TARM1 Protein, N-His

Sign In for Pricing
View Details
SV40 T Ag (Pab 108) Alexa Fluor® 546
sc-148 AF546 200 µg/mL

SV40 T Ag (Pab 108) Alexa Fluor® 546

Sign In for Pricing
View Details
Human Ankyrin repeat domain containing protein 7 (ANKRD7) ELISA Kit
MBS7205644-01 48 Well

Human Ankyrin repeat domain containing protein 7 (ANKRD7) ELISA Kit

Sign In for Pricing
View Details
Human Ankyrin repeat domain containing protein 7 (ANKRD7) ELISA Kit
MBS7205644-02 96 Well

Human Ankyrin repeat domain containing protein 7 (ANKRD7) ELISA Kit

Sign In for Pricing
View Details