Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEZF2 Peptide - C-terminal region

FEZF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FEZF2, FEZL, ZNF312, FKSG36

UniProt

Q8TBJ5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FEZF2 Rabbit Polyclonal Antibody (orb574531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060478

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal RASD2 Antibody (OTI1F7) [Alexa Fluor 405]
NBP2-73808AF405 0.1 mL

Mouse Monoclonal RASD2 Antibody (OTI1F7) [Alexa Fluor 405]

Sign In for Pricing
View Details
SOCS-1 Polyclonal Antibody
MBS8592748-01 0.1 mg

SOCS-1 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS-1 Polyclonal Antibody
MBS8592748-02 0.1 mL (AF405L)

SOCS-1 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS-1 Polyclonal Antibody
MBS8592748-03 0.1 mL (AF405S)

SOCS-1 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS-1 Polyclonal Antibody
MBS8592748-04 0.1 mL (AF610)

SOCS-1 Polyclonal Antibody

Sign In for Pricing
View Details
SOCS-1 Polyclonal Antibody
MBS8592748-05 0.1 mL (AF635)

SOCS-1 Polyclonal Antibody

Sign In for Pricing
View Details