Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FEZF2 Peptide - C-terminal region

FEZF2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FEZF2, FEZL, ZNF312, FKSG36

UniProt

Q8TBJ5

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FEZF2 Rabbit Polyclonal Antibody (orb574531) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_060478

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: THNDKKPFTCATCGKGFCRNFDLKKHVRKLHDSVGPAAPSAKDLTRTVQS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat Olfactory Receptor 3A4 (OR3A4) ELISA Kit
MBS7259386-01 48 Well

Goat Olfactory Receptor 3A4 (OR3A4) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 3A4 (OR3A4) ELISA Kit
MBS7259386-02 96 Well

Goat Olfactory Receptor 3A4 (OR3A4) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 3A4 (OR3A4) ELISA Kit
MBS7259386-03 5x 96 Well

Goat Olfactory Receptor 3A4 (OR3A4) ELISA Kit

Sign In for Pricing
View Details
Goat Olfactory Receptor 3A4 (OR3A4) ELISA Kit
MBS7259386-04 10x 96 Well

Goat Olfactory Receptor 3A4 (OR3A4) ELISA Kit

Sign In for Pricing
View Details
Nori® Equine IL-15 ELISA Kit-Plasma/Serum
GR106033 96 Well

Nori® Equine IL-15 ELISA Kit-Plasma/Serum

Sign In for Pricing
View Details
Progesterone Receptor (NR3C3, Nuclear Receptor subfamily 3 group C Member 3, PGR, PR, PRA, PRB, PRGR_HUMAN, Progesterone Receptor, Progestin Receptor form A, Progestin Receptor form B)
254254 50 µL

Progesterone Receptor (NR3C3, Nuclear Receptor subfamily 3 group C Member 3, PGR, PR, PRA, PRB, PRGR_HUMAN, Progesterone Receptor, Progestin Receptor form A, Progestin Receptor form B)

Sign In for Pricing
View Details