Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX2 Peptide - C-terminal region

P2RX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P2RX2, P2X2

UniProt

Q9UBL9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RX2 Rabbit Polyclonal Antibody (orb575521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Fibronectin (FN) ELISA Kit
MBS459367-01 48 Tests

Human Fibronectin (FN) ELISA Kit

Sign In for Pricing
View Details
Human Fibronectin (FN) ELISA Kit
MBS459367-02 96 Tests

Human Fibronectin (FN) ELISA Kit

Sign In for Pricing
View Details
Human Fibronectin (FN) ELISA Kit
MBS459367-03 5x 96 Tests

Human Fibronectin (FN) ELISA Kit

Sign In for Pricing
View Details
Human Fibronectin (FN) ELISA Kit
MBS459367-04 10x 96 Tests

Human Fibronectin (FN) ELISA Kit

Sign In for Pricing
View Details
Rat Chga (Chromogranin-A) QuickTest ELISA Kit
MBS7618538-01 48 Well

Rat Chga (Chromogranin-A) QuickTest ELISA Kit

Sign In for Pricing
View Details
Rat Chga (Chromogranin-A) QuickTest ELISA Kit
MBS7618538-02 96 Well

Rat Chga (Chromogranin-A) QuickTest ELISA Kit

Sign In for Pricing
View Details