Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

P2RX2 Peptide - C-terminal region

P2RX2 Peptide - C-terminal region

Product Specifications

Product Name Alternative

P2RX2, P2X2

UniProt

Q9UBL9

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with P2RX2 Rabbit Polyclonal Antibody (orb575521) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: PKYSFRRLDPKHVPASSGYNFRFAKYYKINGTTTRTLIKAYGIRIDVIVH

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Transcription Factor p65 Phospho-Thr505 (RELA pT505) Antibody
abx333292 100 µL

Transcription Factor p65 Phospho-Thr505 (RELA pT505) Antibody

Sign In for Pricing
View Details
Uck1-set siRNA/shRNA/RNAi Lentivector (Mouse)
49077094 4x 500 ng

Uck1-set siRNA/shRNA/RNAi Lentivector (Mouse)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum Glutamine amidotransferase subunit pdxT (pdxT)
MBS1252377-01 0.02 mg (E-Coli)

Recombinant Corynebacterium glutamicum Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum Glutamine amidotransferase subunit pdxT (pdxT)
MBS1252377-02 0.1 mg (E-Coli)

Recombinant Corynebacterium glutamicum Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum Glutamine amidotransferase subunit pdxT (pdxT)
MBS1252377-03 0.02 mg (Yeast)

Recombinant Corynebacterium glutamicum Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details
Recombinant Corynebacterium glutamicum Glutamine amidotransferase subunit pdxT (pdxT)
MBS1252377-04 0.1 mg (Yeast)

Recombinant Corynebacterium glutamicum Glutamine amidotransferase subunit pdxT (pdxT)

Sign In for Pricing
View Details