Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

WDR7 Peptide - C-terminal region

WDR7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

WDR7, KIAA0541, TRAG

UniProt

Q9Y4E6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with WDR7 Rabbit Polyclonal Antibody (orb324948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006722494

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LYDIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-NOX5 Antibody Picoband®, iFluor647 Conjugate
A03119-iFluor647 100 µg

Anti-NOX5 Antibody Picoband®, iFluor647 Conjugate

Sign In for Pricing
View Details
Bilastine Impurity 74
RM-B192074-01 10 mg

Bilastine Impurity 74

Sign In for Pricing
View Details
Bilastine Impurity 74
RM-B192074-02 25 mg

Bilastine Impurity 74

Sign In for Pricing
View Details
Bilastine Impurity 74
RM-B192074-03 50 mg

Bilastine Impurity 74

Sign In for Pricing
View Details
Bilastine Impurity 74
RM-B192074-04 100 mg

Bilastine Impurity 74

Sign In for Pricing
View Details
Rabbit anti-Human IgM (u chain), Affinity Pure
MBS689716-01 1 mg

Rabbit anti-Human IgM (u chain), Affinity Pure

Sign In for Pricing
View Details