WDR7 Peptide - C-terminal region
WDR7 Peptide - C-terminal region
Product Specifications
Product Name Alternative
WDR7, KIAA0541, TRAG
UniProt
Q9Y4E6
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with WDR7 Rabbit Polyclonal Antibody (orb324948) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_006722494
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LYDIRTGKCQTIHGHKGPITAVAFAPDGRYLATYSNTDSHISFWQMNTSL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
830070-01 100 mL
Europium (Eu) Atomic Absorption Std. Soln. Contain 1000 mg/lit AAS in HNO 3Nist Traceable
Sign In for Pricing
View Details 830070-02 500 mL
Europium (Eu) Atomic Absorption Std. Soln. Contain 1000 mg/lit AAS in HNO 3Nist Traceable
Sign In for Pricing
View Details 
MBS625007-01 0.05 mg
IkB alpha, phosphorylated (Ser32/Ser36) (NF-kappa-B Inhibitor alpha, I-kappa-B-alpha, IkB-alpha, IkappaBalpha, Major Histocompatibility Complex Enhancer-binding Protein MAD3, NFKBIA, IKBA, MAD3, NFKBI)
Sign In for Pricing
View Details MBS625007-02 5x 0.05 mg
IkB alpha, phosphorylated (Ser32/Ser36) (NF-kappa-B Inhibitor alpha, I-kappa-B-alpha, IkB-alpha, IkappaBalpha, Major Histocompatibility Complex Enhancer-binding Protein MAD3, NFKBIA, IKBA, MAD3, NFKBI)
Sign In for Pricing
View Details 