Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

RPP38 Peptide - C-terminal region

RPP38 Peptide - C-terminal region

Product Specifications

Product Name Alternative

RPP38

UniProt

P78345

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with RPP38 Rabbit Polyclonal Antibody (orb581486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006717427

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: LLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-(2-(Phenylthio)phenyl)dibenzo[b,f][1,4]thiazepin-11-amine
TRC-P337410-25MG 25 mg

N-(2-(Phenylthio)phenyl)dibenzo[b,f][1,4]thiazepin-11-amine

Sign In for Pricing
View Details
Sodium 1-Pentanesulfonate
TRC-S960038-5G 5 g

Sodium 1-Pentanesulfonate

Sign In for Pricing
View Details
DUSP6 Antibody
8C11142-AAT 50 µg

DUSP6 Antibody

Sign In for Pricing
View Details
Troponin T1 (TNNT1) Human Gene Knockout Kit (CRISPR)
KN421318 1 Kit

Troponin T1 (TNNT1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2,3-O-Isopropylidene-D-erythronolactone
TRC-I825000-500MG 500 mg

2,3-O-Isopropylidene-D-erythronolactone

Sign In for Pricing
View Details
Thyroxine Aminohexyl Ether Dihydrochloride
TRC-T425640-5MG 5 mg

Thyroxine Aminohexyl Ether Dihydrochloride

Sign In for Pricing
View Details