RPP38 Peptide - C-terminal region
RPP38 Peptide - C-terminal region
Product Specifications
Product Name Alternative
RPP38
UniProt
P78345
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with RPP38 Rabbit Polyclonal Antibody (orb581486) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
XP_006717427
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: LLDTSFEDLSKPKRKLADGRQASVTLQPLKIKKLIPNPNKIRKPPKSKKA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
RC-15960-01 50 μL
Recombinant Mitochondrial Fission 1 Protein Antibody
Sign In for Pricing
View Details RC-15960-02 100 µL
Recombinant Mitochondrial Fission 1 Protein Antibody
Sign In for Pricing
View Details RC-15960-03 1 mL
Recombinant Mitochondrial Fission 1 Protein Antibody
Sign In for Pricing
View Details 
