Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUBA3E Peptide - middle region

TUBA3E Peptide - middle region

Product Specifications

UniProt

Q6PEY2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with TUBA3E Rabbit Polyclonal Antibody (orb325871) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_997195

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RLSVDYSKKSKLEFAIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVD

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal GPD1L Antibody (14E2) [Alexa Fluor 488]
NBP2-59439AF488 0.1 mL

Mouse Monoclonal GPD1L Antibody (14E2) [Alexa Fluor 488]

Sign In for Pricing
View Details
Glutaredoxin 2 (GLRX2) (NM_016066) Human Tagged ORF Clone
RC215566 10 µg

Glutaredoxin 2 (GLRX2) (NM_016066) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rabbit anti-RFCl Antibody, Affinity Purified
A300-320A 100 µg

Rabbit anti-RFCl Antibody, Affinity Purified

Sign In for Pricing
View Details
MR1 Overexpression Lysate (Native) - (Dry Ice)
NBP2-08196 0.1 mg

MR1 Overexpression Lysate (Native) - (Dry Ice)

Sign In for Pricing
View Details
Rabbit Monoclonal XTP3TPA Antibody (074) [DyLight 550]
NBP2-90294R 0.1 mL

Rabbit Monoclonal XTP3TPA Antibody (074) [DyLight 550]

Sign In for Pricing
View Details
Rabbit Monoclonal B7-1/CD80 Antibody (016) [Alexa Fluor 532]
NBP2-90956AF532 0.1 mL

Rabbit Monoclonal B7-1/CD80 Antibody (016) [Alexa Fluor 532]

Sign In for Pricing
View Details