ATP6V0D2 Peptide - middle region
ATP6V0D2 Peptide - middle region
Product Specifications
Product Name Alternative
ATP6D2, FLJ38708, VMA6
UniProt
Q8N8Y2
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with ATP6V0D2 Rabbit Polyclonal Antibody (orb325998) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_689778
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: MNVLAFNRQFHYGVFYAYVKLKEQEIRNIVWIAECISQRHRTKINSYIPI
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LY401076 100 µg
Fascin (FSCN1) (NM_003088) Human Over-expression Lysate
Sign In for Pricing
View Details 
