Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLAMF8 Peptide - C-terminal region

SLAMF8 Peptide - C-terminal region

Product Specifications

Product Name Alternative

BLAME, CD353, SBBI42

UniProt

Q9P0V8

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SLAMF8 Rabbit Polyclonal Antibody (orb327275) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_064510

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DVLLVVVPVSLLLMLVTLFSAWHWCPCSGKKKKDVHADRVGPETENPLVQ

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TXNL2 (GLRX3) (N-term) Rabbit Polyclonal Antibody
AP54426PU-N 400 µL

TXNL2 (GLRX3) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Isorhapontin
TRC-I214245-2.5MG 2.5 mg

Isorhapontin

Sign In for Pricing
View Details
Mamdc4 Mouse Gene Knockout Kit (CRISPR)
KN309688BN 1 Kit

Mamdc4 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
KAT8 Rabbit Polyclonal Antibody
TA377688 100 µL

KAT8 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Ovary
CS501595 5x 5 µm

Frozen Tissue Sections, Ovary

Sign In for Pricing
View Details
ALDH3A1 (NM_001135168) Human Recombinant Protein
TP325751L 1 mg

ALDH3A1 (NM_001135168) Human Recombinant Protein

Sign In for Pricing
View Details