Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SULT1A2 Peptide - middle region

SULT1A2 Peptide - middle region

Product Specifications

Product Name Alternative

STP2, HAST4, P-PST, ST1A2, TSPST2, P-PST 2

UniProt

P50226

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SULT1A2 Rabbit Polyclonal Antibody (orb327325) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_006721139

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: AKDVAVSYYHFYHMAKVYPHPGTWESFLEKFMAGEVSYGSWYQHVQEWWE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Proliferating Hepatic Duct Fibroblasts Cells (HHDF), fetal
703-75f T-75 Flask

Proliferating Hepatic Duct Fibroblasts Cells (HHDF), fetal

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Adenylate Cyclase 1, Brain (ADCY1)
TRV-0023311-01 200 µL

FITC-Linked Polyclonal Antibody to Adenylate Cyclase 1, Brain (ADCY1)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Adenylate Cyclase 1, Brain (ADCY1)
TRV-0023311-02 1 mL

FITC-Linked Polyclonal Antibody to Adenylate Cyclase 1, Brain (ADCY1)

Sign In for Pricing
View Details
RAPGEF5 (GFR, KIAA0277, MRGEF, Rap Guanine Nucleotide Exchange Factor 5, Guanine Nucleotide Exchange Factor for Rap1, M-Ras-regulated Rap GEF, Related to Epac) (APC)
132313-APC 100 µL

RAPGEF5 (GFR, KIAA0277, MRGEF, Rap Guanine Nucleotide Exchange Factor 5, Guanine Nucleotide Exchange Factor for Rap1, M-Ras-regulated Rap GEF, Related to Epac) (APC)

Sign In for Pricing
View Details
Vienna Speculum 35mm Small
0523-6 5.75 Inches

Vienna Speculum 35mm Small

Sign In for Pricing
View Details
IgG, IgA, IgM, H&L, X-adsorbed (Biotin)
MBS618429-01 1 mg

IgG, IgA, IgM, H&L, X-adsorbed (Biotin)

Sign In for Pricing
View Details