Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SF3B2 Peptide - middle region

SF3B2 Peptide - middle region

Product Specifications

Product Name Alternative

SF3B2, SAP145

UniProt

Q13435

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SF3B2 Rabbit Polyclonal Antibody (orb588475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_006833

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: RVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse General transcription factor IIH subunit 5, GTF2H5 ELISA Kit
MBS9326542-01 48 Well

Mouse General transcription factor IIH subunit 5, GTF2H5 ELISA Kit

Sign In for Pricing
View Details
Mouse General transcription factor IIH subunit 5, GTF2H5 ELISA Kit
MBS9326542-02 96 Well

Mouse General transcription factor IIH subunit 5, GTF2H5 ELISA Kit

Sign In for Pricing
View Details
Mouse General transcription factor IIH subunit 5, GTF2H5 ELISA Kit
MBS9326542-03 5x 96 Well

Mouse General transcription factor IIH subunit 5, GTF2H5 ELISA Kit

Sign In for Pricing
View Details
Mouse General transcription factor IIH subunit 5, GTF2H5 ELISA Kit
MBS9326542-04 10x 96 Well

Mouse General transcription factor IIH subunit 5, GTF2H5 ELISA Kit

Sign In for Pricing
View Details
Cefmetazole sodium
269359-01 100 mg

Cefmetazole sodium

Sign In for Pricing
View Details
Cefmetazole sodium
269359-02 250 mg

Cefmetazole sodium

Sign In for Pricing
View Details