SF3B2 Peptide - middle region
SF3B2 Peptide - middle region
Product Specifications
Product Name Alternative
SF3B2, SAP145
UniProt
Q13435
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SF3B2 Rabbit Polyclonal Antibody (orb588475) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_006833
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: RVRGVSSESSGDREKDSTRSRGSDSPAADVEIEYVTEEPEIYEPNFIFFK
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6208178-01 0.1 mL
PURA (Purine-Rich Element Binding Protein A, PUR-ALPHA, PUR1, PURALPHA) (MaxLight 490)
Sign In for Pricing
View Details MBS6208178-02 5x 0.1 mL
PURA (Purine-Rich Element Binding Protein A, PUR-ALPHA, PUR1, PURALPHA) (MaxLight 490)
Sign In for Pricing
View Details 
038544-ML550 100 µL
MORN1, NT (MORN1, MORN repeat-containing protein 1) (MaxLight 550) discontinued
Sign In for Pricing
View Details GTR10418267 96 Well
Mouse Adeno Associated Virus type 2 Antibody (AAV2-Ab) Elisa kit
Sign In for Pricing
View Details 
K1650304 1.0 µg DNA
PIK3IP1 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details 