SMG6 Peptide - middle region
SMG6 Peptide - middle region
Product Specifications
Product Name Alternative
EST1A, SMG-6, C17orf31, hSMG5/7a
UniProt
Q86US8
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SMG6 Rabbit Polyclonal Antibody (orb588488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: DEVSPTSWGDSRQAQASYYKFQNSDNPYYYPRTPGPASQYPYTGYNPLQY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
abx500494 96 Tests
Mouse Abhydrolase domain-containing protein 1 (ABHD1) ELISA Kit
Sign In for Pricing
View Details 
302696-ML550 100 µL
Ras-GRF1 (phosphorylated Ser916) (Ras-specific Guanine Nucleotide-Releasing Factor 1, Ras-GRF1, CDC25Mm, Guanine Nucleotide-Releasing Protein, GNRP, Ras-specific Nucleotide Exchange Factor CDC25, Rasgrf1, Cdc25, Grf1) (MaxLight 550) discontinued
Sign In for Pricing
View Details