Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMG6 Peptide - middle region

SMG6 Peptide - middle region

Product Specifications

Product Name Alternative

EST1A, SMG-6, C17orf31, hSMG5/7a

UniProt

Q86US8

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SMG6 Rabbit Polyclonal Antibody (orb588488) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DEVSPTSWGDSRQAQASYYKFQNSDNPYYYPRTPGPASQYPYTGYNPLQY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E.coli Host Cell DNA Residue Detection Kit
41304ES50 50 Tests

E.coli Host Cell DNA Residue Detection Kit

Sign In for Pricing
View Details
(2,4-Difluoro-4'-methyl-[1,1'-biphenyl]-3-yl) methanol
PC1018685-01 250 mg

(2,4-Difluoro-4'-methyl-[1,1'-biphenyl]-3-yl) methanol

Sign In for Pricing
View Details
(2,4-Difluoro-4'-methyl-[1,1'-biphenyl]-3-yl) methanol
PC1018685-02 500 mg

(2,4-Difluoro-4'-methyl-[1,1'-biphenyl]-3-yl) methanol

Sign In for Pricing
View Details
Dyrk1B Double Nickase Plasmid (m2)
sc-420084-NIC-2 20 µg

Dyrk1B Double Nickase Plasmid (m2)

Sign In for Pricing
View Details
Aurka (NM_153296) Rat Tagged ORF Clone Lentiviral Particle
RR201216L3V 200 µL

Aurka (NM_153296) Rat Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
ZNF471 Rabbit pAb
E45R23160N-100 100 µL

ZNF471 Rabbit pAb

Sign In for Pricing
View Details