Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISOC2 Peptide - middle region

ISOC2 Peptide - middle region

Product Specifications

Product Name Alternative

ISOC2

UniProt

Q96AB3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ISOC2 Rabbit Polyclonal Antibody (orb588529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILNTTLDLLDRGLQVHV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSP70/HSP72 monoclonal antibody (C92F3A-5) (DyLightTM 488 conjugate)
ADI-SPA-810-488-D 50 µg

HSP70/HSP72 monoclonal antibody (C92F3A-5) (DyLightTM 488 conjugate)

Sign In for Pricing
View Details
Recombinant Human SELE Protein (His Tag)
MBS2581153-01 0.02 mg

Recombinant Human SELE Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SELE Protein (His Tag)
MBS2581153-02 0.1 mg

Recombinant Human SELE Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human SELE Protein (His Tag)
MBS2581153-03 5x 0.1 mg

Recombinant Human SELE Protein (His Tag)

Sign In for Pricing
View Details
Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (MaxLight 650)
MBS6221715-01 0.1 mL

Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (MaxLight 650)

Sign In for Pricing
View Details
Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (MaxLight 650)
MBS6221715-02 5x 0.1 mL

Cyclophilin E (Cyclophilin 33, CYP33, CYP-33, MGC3736, MGC111222, Peptidyl-Prolyl Cis-Trans Isomerase E, PPIase E, PPIE, Rotamase E, Rotamase-E) (MaxLight 650)

Sign In for Pricing
View Details