Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ISOC2 Peptide - middle region

ISOC2 Peptide - middle region

Product Specifications

Product Name Alternative

ISOC2

UniProt

Q96AB3

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ISOC2 Rabbit Polyclonal Antibody (orb588529) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTCFSMVPALQQELDSRPQLRSVLLCGIEAQACILNTTLDLLDRGLQVHV

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MGLL
CSB-CL013787HU 10 μg Plasmid + 200 μL Glycerol

MGLL

Sign In for Pricing
View Details
Recombinant Geobacter sp. Elongation factor Ts (tsf)
MBS1070610-01 0.02 mg (E-Coli)

Recombinant Geobacter sp. Elongation factor Ts (tsf)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Elongation factor Ts (tsf)
MBS1070610-02 0.1 mg (E-Coli)

Recombinant Geobacter sp. Elongation factor Ts (tsf)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Elongation factor Ts (tsf)
MBS1070610-03 0.02 mg (Yeast)

Recombinant Geobacter sp. Elongation factor Ts (tsf)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Elongation factor Ts (tsf)
MBS1070610-04 0.1 mg (Yeast)

Recombinant Geobacter sp. Elongation factor Ts (tsf)

Sign In for Pricing
View Details
Recombinant Geobacter sp. Elongation factor Ts (tsf)
MBS1070610-05 0.02 mg (Baculovirus)

Recombinant Geobacter sp. Elongation factor Ts (tsf)

Sign In for Pricing
View Details