Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THAP7 Peptide - C-terminal region

THAP7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

THAP7

UniProt

Q9BT49

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THAP7 Rabbit Polyclonal Antibody (orb327404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_085050

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPGLSSPFSDLLGPLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Connexin-40 Polyclonal Antibody
E-AB-70357-01 60 µL

Connexin-40 Polyclonal Antibody

Sign In for Pricing
View Details
Connexin-40 Polyclonal Antibody
E-AB-70357-02 120 µL

Connexin-40 Polyclonal Antibody

Sign In for Pricing
View Details
Connexin-40 Polyclonal Antibody
E-AB-70357-03 200 µL

Connexin-40 Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Trk-B Antibody
RC-6407-01 50 μL

Recombinant Trk-B Antibody

Sign In for Pricing
View Details
Recombinant Trk-B Antibody
RC-6407-02 100 µL

Recombinant Trk-B Antibody

Sign In for Pricing
View Details
Recombinant Trk-B Antibody
RC-6407-03 1 mL

Recombinant Trk-B Antibody

Sign In for Pricing
View Details