Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THAP7 Peptide - C-terminal region

THAP7 Peptide - C-terminal region

Product Specifications

Product Name Alternative

THAP7

UniProt

Q9BT49

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with THAP7 Rabbit Polyclonal Antibody (orb327404) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_085050

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: EPGLSSPFSDLLGPLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stability Test Chamber BTST-1608
BTST-1608 1 Unit

Stability Test Chamber BTST-1608

Sign In for Pricing
View Details
Human FGF20 activation kit by CRISPRa
GA108843 1 Kit

Human FGF20 activation kit by CRISPRa

Sign In for Pricing
View Details
DPPA4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F6]
TA800036AM 100 µL

DPPA4 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2F6]

Sign In for Pricing
View Details
Smooth Muscle Actin (ACTA2/791 +1A4), CF405S conjugate, 0.1mg/mL
BNC041203-500 1x 500 µL

Smooth Muscle Actin (ACTA2/791 +1A4), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Cervix
CS802138 5x 5 µm

Tissue FFPE Sections, Cervix

Sign In for Pricing
View Details
AGPAT7 (LPCAT4) (NM_153613) Human Recombinant Protein
TP310488 20 µg

AGPAT7 (LPCAT4) (NM_153613) Human Recombinant Protein

Sign In for Pricing
View Details