Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMCES Peptide - N-terminal region

HMCES Peptide - N-terminal region

Product Specifications

Product Name Alternative

HMCES, C3orf37, DC12, SRAPD1

UniProt

Q96FZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HMCES Rabbit Polyclonal Antibody (orb326194) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005247693

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALS2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
11805111 3x 1.0 µg

ALS2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Armenian Hamster Monoclonal Myc Epitope Tag Antibody (9E10) [DyLight 405]
NBP2-81019V 0.1 mL

Armenian Hamster Monoclonal Myc Epitope Tag Antibody (9E10) [DyLight 405]

Sign In for Pricing
View Details
Recombinant human MASP2 protein, N-His
bs-42117P-01 100 µg

Recombinant human MASP2 protein, N-His

Sign In for Pricing
View Details
Recombinant human MASP2 protein, N-His
bs-42117P-02 500 µg

Recombinant human MASP2 protein, N-His

Sign In for Pricing
View Details
CD56 (Neural Cell Adhesion Molecule 1, N-CAM-1, NCAM-1, NCAM1, NCAM) (MaxLight 405)
MBS6188551-01 0.1 mL

CD56 (Neural Cell Adhesion Molecule 1, N-CAM-1, NCAM-1, NCAM1, NCAM) (MaxLight 405)

Sign In for Pricing
View Details
CD56 (Neural Cell Adhesion Molecule 1, N-CAM-1, NCAM-1, NCAM1, NCAM) (MaxLight 405)
MBS6188551-02 5x 0.1 mL

CD56 (Neural Cell Adhesion Molecule 1, N-CAM-1, NCAM-1, NCAM1, NCAM) (MaxLight 405)

Sign In for Pricing
View Details