Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HMCES Peptide - N-terminal region

HMCES Peptide - N-terminal region

Product Specifications

Product Name Alternative

HMCES, C3orf37, DC12, SRAPD1

UniProt

Q96FZ2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with HMCES Rabbit Polyclonal Antibody (orb326194) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

XP_005247693

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: GQQRLPEWRDPDKYCPSYNKSPQSNSPVLLSRLHFEKDADSSERIIAPMR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal RBFOX3/NeuN Antibody (NEUN/8096R) [DyLight 405]
NBP3-24116V 0.1 mL

Rabbit Monoclonal RBFOX3/NeuN Antibody (NEUN/8096R) [DyLight 405]

Sign In for Pricing
View Details
Aggf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4064505 3x 1.0 µg

Aggf1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
VAV1 (189-565, His-tag) Human Protein
AR51244PU-N 100 µg

VAV1 (189-565, His-tag) Human Protein

Sign In for Pricing
View Details
DBC1 (phospho-Thr454) rabbit pAb
E28PP1312 100 µL

DBC1 (phospho-Thr454) rabbit pAb

Sign In for Pricing
View Details
RAB39A antibody
FNab07022 100 µg

RAB39A antibody

Sign In for Pricing
View Details
GalNAc-TL4 Lentiviral Activation Particles (h)
sc-415682-LAC 200 µL

GalNAc-TL4 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details