SKI Peptide - middle region
SKI Peptide - middle region
Product Specifications
Product Name Alternative
SKI
UniProt
P12755
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SKI Rabbit Polyclonal Antibody (orb588440) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
NCBI Accession Number
NP_003027
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: VKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKDKPSSWL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS1307166-01 0.02 mg (E-Coli)
Recombinant Meleagris gallopavo Delta-1 crystallin (ASL1)
Sign In for Pricing
View Details MBS1307166-02 0.02 mg (Yeast)
Recombinant Meleagris gallopavo Delta-1 crystallin (ASL1)
Sign In for Pricing
View Details MBS1307166-03 0.1 mg (E-Coli)
Recombinant Meleagris gallopavo Delta-1 crystallin (ASL1)
Sign In for Pricing
View Details MBS1307166-04 0.1 mg (Yeast)
Recombinant Meleagris gallopavo Delta-1 crystallin (ASL1)
Sign In for Pricing
View Details MBS1307166-05 0.02 mg (Baculovirus)
Recombinant Meleagris gallopavo Delta-1 crystallin (ASL1)
Sign In for Pricing
View Details MBS1307166-06 0.02 mg (Mammalian-Cell)
Recombinant Meleagris gallopavo Delta-1 crystallin (ASL1)
Sign In for Pricing
View Details