Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SKI Peptide - middle region

SKI Peptide - middle region

Product Specifications

Product Name Alternative

SKI

UniProt

P12755

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SKI Rabbit Polyclonal Antibody (orb588440) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_003027

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: VKEKFDYGNKYKRRVPRVSSEPPASIRPKTDDTSSQSPAPSEKDKPSSWL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Rhd shRNA (UAS) - Lentiviral mouse Rhd shRNA (UAS) plasmid
GTR15210199 1 Vial

Lentiviral mouse Rhd shRNA (UAS) - Lentiviral mouse Rhd shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Human WFDC2/WAP5/HE4 Protein, C-Fc
orb3152466-01 50 µg

Recombinant Human WFDC2/WAP5/HE4 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human WFDC2/WAP5/HE4 Protein, C-Fc
orb3152466-02 100 µg

Recombinant Human WFDC2/WAP5/HE4 Protein, C-Fc

Sign In for Pricing
View Details
Recombinant Human WFDC2/WAP5/HE4 Protein, C-Fc
orb3152466-03 1 mg

Recombinant Human WFDC2/WAP5/HE4 Protein, C-Fc

Sign In for Pricing
View Details
XRCC1 (X-Ray Repair Cross Complementing Protein1) (BSA & Azide Free)
MBS602546-01 0.1 mL

XRCC1 (X-Ray Repair Cross Complementing Protein1) (BSA & Azide Free)

Sign In for Pricing
View Details
XRCC1 (X-Ray Repair Cross Complementing Protein1) (BSA & Azide Free)
MBS602546-02 5x 0.1 mL

XRCC1 (X-Ray Repair Cross Complementing Protein1) (BSA & Azide Free)

Sign In for Pricing
View Details