Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SCIN Peptide - middle region

SCIN Peptide - middle region

Product Specifications

Product Name Alternative

KIAA1905

UniProt

Q9Y6U3

Field of Research

Musculoskeletal & Connective Tissue Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with SCIN Rabbit Polyclonal Antibody (orb327412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: KTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pilrb1 shRNA (UAS) - Lentiviral mouse Pilrb1 shRNA (UAS, iRFP) plasmid
GTR15164032 1 Vial

Lentiviral mouse Pilrb1 shRNA (UAS) - Lentiviral mouse Pilrb1 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
LETM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
26452111 3x 1.0 µg

LETM1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ADAM15 Antibody, FITC conjugated
A32594-100UG 100 µg

ADAM15 Antibody, FITC conjugated

Sign In for Pricing
View Details
ALK-1 Polyclonal Antibody
ABP52913-01 30 µL

ALK-1 Polyclonal Antibody

Sign In for Pricing
View Details
ALK-1 Polyclonal Antibody
ABP52913-02 100 µL

ALK-1 Polyclonal Antibody

Sign In for Pricing
View Details
ALK-1 Polyclonal Antibody
ABP52913-03 200 µL

ALK-1 Polyclonal Antibody

Sign In for Pricing
View Details