SCIN Peptide - middle region
SCIN Peptide - middle region
Product Specifications
Product Name Alternative
KIAA1905
UniProt
Q9Y6U3
Field of Research
Musculoskeletal & Connective Tissue Research
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with SCIN Rabbit Polyclonal Antibody (orb327412) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Preservative
Lyophilized powder
AA Sequence
Synthetic peptide located within the following region: KTAEEFLQQMNYSKNTQIQVLPEGGETPIFKQFFKDWRDKDQSDGFGKVY
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
VAng-Wyb0094-500gEcoli 500 µg (E. coli)
Recombinant Leptospira Biflexa LEPBI_I1392 protein (aa 1-165)
Sign In for Pricing
View Details 