Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDOA Peptide - N-terminal region

ALDOA Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALDOA, ALDA

UniProt

P04075

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDOA Rabbit Polyclonal Antibody (orb588555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_908932

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TORC2 (CRTC2) (NM_181715) Human Over-expression Lysate
LS200186-20ug 20 µg

TORC2 (CRTC2) (NM_181715) Human Over-expression Lysate

Sign In for Pricing
View Details
DAP5 Polyclonal Antibody, APC-Cy7 Conjugated
bs-1350R-APC-Cy7 100 µL

DAP5 Polyclonal Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
Caveolin-1 Polyclonal Antibody
bs-23173R 100 µL

Caveolin-1 Polyclonal Antibody

Sign In for Pricing
View Details
REG4 Recombinant Rabbit mAb
E43S49125 100 µL

REG4 Recombinant Rabbit mAb

Sign In for Pricing
View Details
LGALS3 Antibody
orb2309930-01 20 µg

LGALS3 Antibody

Sign In for Pricing
View Details
LGALS3 Antibody
orb2309930-02 100 µg

LGALS3 Antibody

Sign In for Pricing
View Details