Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ALDOA Peptide - N-terminal region

ALDOA Peptide - N-terminal region

Product Specifications

Product Name Alternative

ALDOA, ALDA

UniProt

P04075

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ALDOA Rabbit Polyclonal Antibody (orb588555) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_908932

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: CIGGVILFHETLYQKADDGRPFPQVIKSKGGVVGIKVDKGVVPLAGTNGE

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FUT11 3'UTR GFP Stable Cell Line
TU058401 1.0 mL

FUT11 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Recombinant Human Indoleamine 23-dioxygenase/IDO Protein
NBP2-51723-0.1mg 0.1 mg

Recombinant Human Indoleamine 23-dioxygenase/IDO Protein

Sign In for Pricing
View Details
NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF647 conjugate, 0.1mg/mL
BNC471670-500 1x 500 µL

NSE gamma (Neuron Specific Enolase, gamma) (Neuroendocrine Marker) (NSE-P2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Purple sea urchin RNAbind Rabbit Polyclonal Antibody (Fluoro550)
orb3086818 200 µL

Purple sea urchin RNAbind Rabbit Polyclonal Antibody (Fluoro550)

Sign In for Pricing
View Details
PE Anti-Human CD11c Antibody
RD21452F-01 20 Tests

PE Anti-Human CD11c Antibody

Sign In for Pricing
View Details
PE Anti-Human CD11c Antibody
RD21452F-02 100 Tests

PE Anti-Human CD11c Antibody

Sign In for Pricing
View Details