Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CD247 Peptide - middle region

CD247 Peptide - middle region

Product Specifications

Product Name Alternative

T3Z, CD3H, CD3Q, CD3Z, TCRZ, IMD25, CD3-ZETA

UniProt

P20963

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CD247 Rabbit Polyclonal Antibody (orb327431) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

NCBI Accession Number

NP_932170

Preservative

Lyophilized powder

AA Sequence

Synthetic peptide located within the following region: DAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPQRRKNPQEG

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AXL (AXL Receptor Tyrosine Kinase, JTK11, UFO) (MAXLight 490)
MBS6205294-01 0.1 mL

AXL (AXL Receptor Tyrosine Kinase, JTK11, UFO) (MAXLight 490)

Sign In for Pricing
View Details
AXL (AXL Receptor Tyrosine Kinase, JTK11, UFO) (MAXLight 490)
MBS6205294-02 5x 0.1 mL

AXL (AXL Receptor Tyrosine Kinase, JTK11, UFO) (MAXLight 490)

Sign In for Pricing
View Details
mmu-miR-181d-3p miRNA Antagomir
MBS8319507-01 10 nmol

mmu-miR-181d-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-181d-3p miRNA Antagomir
MBS8319507-02 20 nmol

mmu-miR-181d-3p miRNA Antagomir

Sign In for Pricing
View Details
mmu-miR-181d-3p miRNA Antagomir
MBS8319507-03 5x 20 nmol

mmu-miR-181d-3p miRNA Antagomir

Sign In for Pricing
View Details
TRP 7/TRPC7 Rabbit Polyclonal Antibody (APC)
orb2622830 100 µg

TRP 7/TRPC7 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details